Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAZ2 Rabbit pAb (APR27534N)

Product Specifications

Background

This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF) . Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains one copy of the 10.8 kb repeat. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DAZ2 Rabbit pAb (APR27534N) .

Synonyms

DAZ2; pDP1678

Gene ID

57055

UniProt

Q13117

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa/60kDa/63kDa Observed MW: 63kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57055

Uniprot URL

https://www.uniprot.org/uniprot/Q13117

AA Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mmu-miR-12181-5p antagomir
HY-RI02594A-01 5 nmol

Mmu-miR-12181-5p antagomir

Ask
View Details
Mmu-miR-12181-5p antagomir
HY-RI02594A-02 20 nmol

Mmu-miR-12181-5p antagomir

Ask
View Details
Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)
MBS1191789-01 0.02 mg (E-Coli)

Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)

Ask
View Details
Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)
MBS1191789-02 0.02 mg (Yeast)

Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)

Ask
View Details
Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)
MBS1191789-03 0.1 mg (E-Coli)

Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)

Ask
View Details
Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)
MBS1191789-04 0.1 mg (Yeast)

Recombinant Nicotiana tabacum Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (accD)

Ask
View Details