Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR4 Rabbit pAb (APR27496N)

Product Specifications

Background

The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. The genomic organization of this gene, compared to members 1-3, encompasses 18 exons rather than 19 or 20. Although alternative splicing has been observed, there is no evidence that the C-terminal half of the IgIII domain of this protein varies between three alternate forms, as indicated for members 1-3. This particular family member preferentially binds acidic fibroblast growth factor and, although its specific function is unknown, it is overexpressed in gynecological tumor samples, suggesting a role in breast and ovarian tumorigenesis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FGFR4 Rabbit pAb (APR27496N) .

Synonyms

FGFR4; CD334; JTK2; TKF

Gene ID

2264

UniProt

P22455

Cellular Locus

Cell membrane, Cytoplasm, Endoplasmic reticulum, Endosome, Secreted, Single-pass type I membrane protein

Applications

WB (HeLa cells)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa/83kDa/87kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2264

Uniprot URL

https://www.uniprot.org/uniprot/P22455

AA Sequence

LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNTA1 AAV Vector (Human) (CMV)
45009101 1 µg

SNTA1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CDA, ID (CDA, CDD, Cytidine deaminase, Cytidine aminohydrolase) (MaxLight 405) discontinued
033560-ML405 100 µL

CDA, ID (CDA, CDD, Cytidine deaminase, Cytidine aminohydrolase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Sars2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6129705 3x 1.0 µg

Sars2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
SLAMF6 protein (His tag)
80R-2591 0.1 mg

SLAMF6 protein (His tag)

Sign In for Pricing
View Details
MARCH10 Rabbit Polyclonal Antibody (PE-Cy7)
orb956988 100 µL

MARCH10 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
C6, NT (Complement Component C6) (APC) discontinued
C7850-35G-APC 200 µL

C6, NT (Complement Component C6) (APC) discontinued

Sign In for Pricing
View Details