Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPAS1/HIF2α Rabbit pAb (APR27494N)

Product Specifications

Background

This gene encodes a transcription factor involved in the induction of genes regulated by oxygen, which is induced as oxygen levels fall. The encoded protein contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. Mutations in this gene are associated with erythrocytosis familial type 4.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EPAS1/HIF2α Rabbit pAb (APR27494N) .

Synonyms

EPAS1; ECYT4; HIF2A; HLF; MOP2; PASD2; bHLHe73

Gene ID

2034

UniProt

Q99814

Cellular Locus

Nucleus, Nucleus speckle

Applications

IF (Mus musculus) WB (Homo sapiens) IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 96kDa Observed MW: 120kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2034

Uniprot URL

https://www.uniprot.org/uniprot/Q99814

AA Sequence

FQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Toxoplasma Gondii ROM4 Protein (aa 1-641) (Cell Free Expression)
VAng-0473Lsx-50g 50 µg

Recombinant Toxoplasma Gondii ROM4 Protein (aa 1-641) (Cell Free Expression)

Sign In for Pricing
View Details
Ovol1 Polyclonal Antibody
UB-GEN-1890 100 µL

Ovol1 Polyclonal Antibody

Sign In for Pricing
View Details
AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Si
MBS6002194-01 0.2 mL

AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Si

Sign In for Pricing
View Details
AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Si
MBS6002194-02 5x 0.2 mL

AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Si

Sign In for Pricing
View Details
MiR-211 lentivirus (EF1a, Puro) - miR-211 lentivirus (EF1a, Puro)
GTR15425152 25 µL (1x 25 µL)

MiR-211 lentivirus (EF1a, Puro) - miR-211 lentivirus (EF1a, Puro)

Sign In for Pricing
View Details
LSM14A Rabbit pAb
E45R23276N-100 100 µL

LSM14A Rabbit pAb

Sign In for Pricing
View Details