Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX10 Rabbit pAb (APR27488N)

Product Specifications

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes heme A:farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX. This protein is predicted to contain 7-9 transmembrane domains localized in the mitochondrial inner membrane. A gene mutation, which results in the substitution of a lysine for an asparagine (N204K), is identified to be responsible for cytochrome c oxidase deficiency. In addition, this gene is disrupted in patients with CMT1A (Charcot-Marie-Tooth type 1A) duplication and with HNPP (hereditary neuropathy with liability to pressure palsies) deletion.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COX10 Rabbit pAb (APR27488N) .

Synonyms

COX10

Gene ID

1352

UniProt

Q12887

Cellular Locus

Mitochondrion membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/48kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1352

Uniprot URL

https://www.uniprot.org/uniprot/Q12887

AA Sequence

MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-20 Antibody (03) [Alexa Fluor 647]
NBP3-26912AF647 0.1 mL

Mouse Monoclonal IL-20 Antibody (03) [Alexa Fluor 647]

Sign In for Pricing
View Details
Anti-Met (c-Met) Antibody Picoband® (APC Conjugate)
PB9186-APC 100 µg/Vial

Anti-Met (c-Met) Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
Mouse Rtn3 Pre-designed siRNA Set A
SI112369A 1 Each

Mouse Rtn3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD23 Monoclonal Antibody, AbBy Fluor™ 488 Conjugated
bsm-33088M-BF488 100 µL

CD23 Monoclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Chicken alpha2-M (Alpha-2 Macroglobulin) ELISA Kit
MBS2512330-01 24 Tests

Chicken alpha2-M (Alpha-2 Macroglobulin) ELISA Kit

Sign In for Pricing
View Details
Chicken alpha2-M (Alpha-2 Macroglobulin) ELISA Kit
MBS2512330-02 48 Tests

Chicken alpha2-M (Alpha-2 Macroglobulin) ELISA Kit

Sign In for Pricing
View Details