Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B Rabbit pAb (APR27465N)

Product Specifications

Background

Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]) .[supplied by OMIM, Jan 2009]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RAB1B Rabbit pAb (APR27465N) .

Synonyms

RAB1B

Gene ID

81876

UniProt

Q9H0U4

Cellular Locus

Cytoplasm, Cytoplasmic side, Lipid-anchor, Membrane, Preautophagosomal structure membrane

Applications

WB (Human liver cancer, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 28kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81876

Uniprot URL

https://www.uniprot.org/uniprot/Q9H0U4

AA Sequence

YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD177 qPCR Primer Pair
QH47437S 200 Tests

Human CD177 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse 5-Nucleotidase,5-NT ELISA Kit
CSB-E04682m-01 48 Tests

Mouse 5-Nucleotidase,5-NT ELISA Kit

Sign In for Pricing
View Details
Mouse 5-Nucleotidase,5-NT ELISA Kit
CSB-E04682m-02 96 Tests

Mouse 5-Nucleotidase,5-NT ELISA Kit

Sign In for Pricing
View Details
Mouse 5-Nucleotidase,5-NT ELISA Kit
CSB-E04682m-03 5x 96 Tests

Mouse 5-Nucleotidase,5-NT ELISA Kit

Sign In for Pricing
View Details
Mouse 5-Nucleotidase,5-NT ELISA Kit
CSB-E04682m-04 10x 96 Tests

Mouse 5-Nucleotidase,5-NT ELISA Kit

Sign In for Pricing
View Details
LCK (Lymphocyte-Specific Protein Tyrosine Kinase, YT16, p56lck, pp58lck) (FITC)
MBS6177584-01 0.1 mL

LCK (Lymphocyte-Specific Protein Tyrosine Kinase, YT16, p56lck, pp58lck) (FITC)

Sign In for Pricing
View Details