Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBA3 Rabbit pAb (APR27456N)

Product Specifications

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBA3 Rabbit pAb (APR27456N) .

Synonyms

UBA3; NAE2; UBE1C; hUBA3

Gene ID

9039

UniProt

Q8TBC4

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa/51kDa Observed MW: 52kDa/104kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9039

Uniprot URL

https://www.uniprot.org/uniprot/Q8TBC4

AA Sequence

FPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CTBP2 Antibody (PCRP-CTBP2-2D11) [Alexa Fluor 488]
NBP3-08550AF488 100 µL

Mouse Monoclonal CTBP2 Antibody (PCRP-CTBP2-2D11) [Alexa Fluor 488]

Sign In for Pricing
View Details
Lentiviral human HMX2 shRNA (UAS) - Lentiviral human HMX2 shRNA (UAS, GFP) (25)
GTR15339971 1 Vial

Lentiviral human HMX2 shRNA (UAS) - Lentiviral human HMX2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)
MBS1423538-01 0.02 mg (E-Coli)

Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)
MBS1423538-02 0.02 mg (Yeast)

Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)
MBS1423538-03 0.1 mg (E-Coli)

Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)

Sign In for Pricing
View Details
Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)
MBS1423538-04 0.1 mg (Yeast)

Recombinant Neurospora crassa Phosphatidylinositol transfer protein sfh-5 (sfh-5)

Sign In for Pricing
View Details