Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF24 Rabbit pAb (APR27452N)

Product Specifications

Background

Transcription factor required for myelination of differentiated oligodendrocytes. Required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS, involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence (By similarity. Has transcription repressor activity in vitro.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF24 Rabbit pAb (APR27452N) .

Synonyms

ZNF24; KOX17; RSG-A; ZNF191; ZSCAN3; Zfp191

Gene ID

7572

UniProt

P17028

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7572

Uniprot URL

https://www.uniprot.org/uniprot/P17028

AA Sequence

LDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-PTPN6 / SHP1 (internal region) Antibody
dAP-1056 50 µg

Goat anti-PTPN6 / SHP1 (internal region) Antibody

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)
MBS1022154-01 0.02 mg (E-Coli)

Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)
MBS1022154-02 0.02 mg (Yeast)

Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)
MBS1022154-03 0.1 mg (E-Coli)

Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)
MBS1022154-04 0.1 mg (Yeast)

Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)
MBS1022154-05 0.02 mg (Baculovirus)

Recombinant Treponema pallidum Uncharacterized lipoprotein TP_0136 (TP_0136)

Sign In for Pricing
View Details