Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK13 Rabbit pAb (APR27448N)

Product Specifications

Background

This gene encodes a member of the mitogen-activated protein (MAP) kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The encoded protein is a p38 MAP kinase and is activated by proinflammatory cytokines and cellular stress. Substrates of the encoded protein include the transcription factor ATF2 and the microtubule dynamics regulator stathmin. Alternatively spliced transcript variants have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MAPK13 Rabbit pAb (APR27448N) .

Synonyms

MAPK13; MAPK 13; MAPK-13; PRKM13; SAPK4; p38delta

Gene ID

5603

UniProt

O15264

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/42kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5603

Uniprot URL

https://www.uniprot.org/uniprot/O15264

AA Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCAR siRNA (Human)
CRH1539-01 15 nmol

FCAR siRNA (Human)

Sign In for Pricing
View Details
FCAR siRNA (Human)
CRH1539-02 30 nmol

FCAR siRNA (Human)

Sign In for Pricing
View Details
NCOA5 Polyclonal Antibody
MBS9236944-01 0.1 mL

NCOA5 Polyclonal Antibody

Sign In for Pricing
View Details
NCOA5 Polyclonal Antibody
MBS9236944-02 5x 0.1 mL

NCOA5 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Complement Component 4d (C4d)
TRV-0052954-01 10 µg

Recombinant Complement Component 4d (C4d)

Sign In for Pricing
View Details
Recombinant Complement Component 4d (C4d)
TRV-0052954-02 50 µg

Recombinant Complement Component 4d (C4d)

Sign In for Pricing
View Details