Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJB9 Rabbit pAb (APR27446N)

Product Specifications

Background

This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. This gene is a member of the type 2 subgroup of DnaJ proteins. The encoded protein is localized to the endoplasmic reticulum. This protein is induced by endoplasmic reticulum stress and plays a role in protecting stressed cells from apoptosis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DNAJB9 Rabbit pAb (APR27446N) .

Synonyms

DNAJB9; ERdj4; MDG-1; MDG1; MST049; MSTP049

Gene ID

4189

UniProt

Q9UBS3

Cellular Locus

Endoplasmic reticulum lumen

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 25kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4189

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBS3

AA Sequence

SKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AMPK (G1/B1/A1) Heterotrimer Protein
MBS2545015-01 0.05 mg

Recombinant Human AMPK (G1/B1/A1) Heterotrimer Protein

Sign In for Pricing
View Details
Recombinant Human AMPK (G1/B1/A1) Heterotrimer Protein
MBS2545015-02 5x 0.05 mg

Recombinant Human AMPK (G1/B1/A1) Heterotrimer Protein

Sign In for Pricing
View Details
WDR77 Rabbit Polyclonal Antibody
E10G08998 100 µL

WDR77 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE Anti-Human CD15 Antibody
DL20915F-01 20 Tests

PE Anti-Human CD15 Antibody

Sign In for Pricing
View Details
PE Anti-Human CD15 Antibody
DL20915F-02 50 Tests

PE Anti-Human CD15 Antibody

Sign In for Pricing
View Details
PE Anti-Human CD15 Antibody
DL20915F-03 100 Tests

PE Anti-Human CD15 Antibody

Sign In for Pricing
View Details