Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP110 Rabbit pAb (APR27444N)

Product Specifications

Background

The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SP110 Rabbit pAb (APR27444N) .

Synonyms

SP110; IFI41; IFI75; IPR1; VODI

Gene ID

3431

UniProt

Q9HB58

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/46kDa/61kDa/62kDa/78kDa/81kDa Observed MW: 78kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3431

Uniprot URL

https://www.uniprot.org/uniprot/Q9HB58

AA Sequence

MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILTQLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYERQSRDTPILLEAPTGLAEGSSLHTPLALPPPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKRKRCIWSTPKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD7 Antibody (N-term)
E45R05092G-1 100 µL

PSMD7 Antibody (N-term)

Sign In for Pricing
View Details
HDAC3 Antibody
orb97555 100 µL

HDAC3 Antibody

Sign In for Pricing
View Details
Hsa-miR-4802-3p miRNA Agomir
CMJ1715-01 5 nmol

Hsa-miR-4802-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4802-3p miRNA Agomir
CMJ1715-02 10 nmol

Hsa-miR-4802-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4802-3p miRNA Agomir
CMJ1715-03 20 nmol

Hsa-miR-4802-3p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Haloquadratum walsbyi Anthranilate phosphoribosyltransferase (trpD)
MBS1436592-01 0.02 mg (E-Coli)

Recombinant Haloquadratum walsbyi Anthranilate phosphoribosyltransferase (trpD)

Sign In for Pricing
View Details