Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibronectin Rabbit pAb (APR27440N)

Product Specifications

Background

This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. The encoded preproprotein is proteolytically processed to generate the mature protein. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing. The full-length nature of some variants has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Fibronectin Rabbit pAb (APR27440N) .

Synonyms

FN1; CIG; ED-B; FINC; FN; FNZ; GFND; GFND2; LETS; MSF; fibronectin

Gene ID

2335

UniProt

P02751

Cellular Locus

Secreted, extracellular matrix, extracellular space

Applications

IF (Homo sapiens) WB (Rattus norvegicus, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 71-73kDa/221-272kDa Observed MW: 290kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2335

Uniprot URL

https://www.uniprot.org/uniprot/P02751

AA Sequence

MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human CD134/TNFRSF4/OX40 (YH-002)
MBS1581372-01 0.1 mg

Research Grade Anti-Human CD134/TNFRSF4/OX40 (YH-002)

Sign In for Pricing
View Details
Research Grade Anti-Human CD134/TNFRSF4/OX40 (YH-002)
MBS1581372-02 1 mg

Research Grade Anti-Human CD134/TNFRSF4/OX40 (YH-002)

Sign In for Pricing
View Details
Research Grade Anti-Human CD134/TNFRSF4/OX40 (YH-002)
MBS1581372-03 5x 1 mg

Research Grade Anti-Human CD134/TNFRSF4/OX40 (YH-002)

Sign In for Pricing
View Details
Mouse Monoclonal LIN7B Antibody (OTI1C9) [DyLight 405]
NBP2-72131V 0.1 mL

Mouse Monoclonal LIN7B Antibody (OTI1C9) [DyLight 405]

Sign In for Pricing
View Details
Rabbit Polyclonal PHD4/HIF Prolyl Hydroxylase 4 Antibody [Dylight 755]
NB100-295IR 0.1 mL

Rabbit Polyclonal PHD4/HIF Prolyl Hydroxylase 4 Antibody [Dylight 755]

Sign In for Pricing
View Details
Human Interleukin 10 Receptor, Beta, IL10RB ELISA Kit
DEIA256-01 5 plates

Human Interleukin 10 Receptor, Beta, IL10RB ELISA Kit

Sign In for Pricing
View Details