Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ULK4 Rabbit pAb (APR27423N)

Product Specifications

Background

This gene encodes a member of the unc-51-like serine/threonine kinase (STK) family. Members of this protein family play a role in neuronal growth and endocytosis. The encoded protein is likely involved in neurite branching, neurite elongation and neuronal migration. Genome-wide association studies (GWAS) indicate an association of variations in this gene with blood pressure and hypertension. Sequence variations in this gene may also be be associated with psychiatric disorders, including schizophrenia and bipolar disorder. Pseudogenes associated with this gene have been identified and are located on chromosome 15.

Synonyms

ULK4; FAM7C1; REC01035

Gene ID

54986

UniProt

Q96C45

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 142kDa Observed MW: 160KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ULK4 Rabbit pAb (APR27423N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54986

Uniprot URL

https://www.uniprot.org/uniprot/Q96C45

AA Sequence

MENFILYEEIGRGSKTVVYKGRRKGTINFVAILCTDKCKRPEITNWVRLTREIKHKNIVTFHEWYETSNHLWLVVELCTGGSLKTVIAQDENLPEDVVREFGIDLISGLHHLHKLGILFCDISPRKILLEGPGTLKFSNFCLAKVEGENLEEFFALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAPEVVRGADFSISSDLWSLGCLLYEMFSGKPPFFSESISELTEKILCEDPLPPIPKDSSRPKASSDFINLLDGLLQRDPQKRLTWTRLLQHSFWKKAFAGADQE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Easypro Human Cd4 (Cluster of Differentiation 4) ELISA Kit
FY-EH1418S 96 Well

Easypro Human Cd4 (Cluster of Differentiation 4) ELISA Kit

Ask
View Details
CHIP, CT (E3 Ubiquitin-protein Ligase CHIP, Carboxy Terminus of HSP70-interacting Protein, CLL-associated Antigen KW-8, STIP1 Homology and U-Box Containing Protein 1, Antigen NY-CO-7, STUB1, PP1131) (MaxLight 405)
MBS6468709-01 0.1 mL

CHIP, CT (E3 Ubiquitin-protein Ligase CHIP, Carboxy Terminus of HSP70-interacting Protein, CLL-associated Antigen KW-8, STIP1 Homology and U-Box Containing Protein 1, Antigen NY-CO-7, STUB1, PP1131) (MaxLight 405)

Ask
View Details
CHIP, CT (E3 Ubiquitin-protein Ligase CHIP, Carboxy Terminus of HSP70-interacting Protein, CLL-associated Antigen KW-8, STIP1 Homology and U-Box Containing Protein 1, Antigen NY-CO-7, STUB1, PP1131) (MaxLight 405)
MBS6468709-02 5x 0.1 mL

CHIP, CT (E3 Ubiquitin-protein Ligase CHIP, Carboxy Terminus of HSP70-interacting Protein, CLL-associated Antigen KW-8, STIP1 Homology and U-Box Containing Protein 1, Antigen NY-CO-7, STUB1, PP1131) (MaxLight 405)

Ask
View Details
AFP Polyclonal Antibody Bio Conjugated
C92247Bio 100 µL

AFP Polyclonal Antibody Bio Conjugated

Ask
View Details
EIF2alpha (Phospho-Ser51) Colorimetric Cell-Based ELISA Kit
EKC2394 1 Kit, Containing two 96 Well Plates and all necessary reagents

EIF2alpha (Phospho-Ser51) Colorimetric Cell-Based ELISA Kit

Ask
View Details