Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ULK4 Rabbit pAb (APR27423N)

Product Specifications

Background

This gene encodes a member of the unc-51-like serine/threonine kinase (STK) family. Members of this protein family play a role in neuronal growth and endocytosis. The encoded protein is likely involved in neurite branching, neurite elongation and neuronal migration. Genome-wide association studies (GWAS) indicate an association of variations in this gene with blood pressure and hypertension. Sequence variations in this gene may also be be associated with psychiatric disorders, including schizophrenia and bipolar disorder. Pseudogenes associated with this gene have been identified and are located on chromosome 15.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ULK4 Rabbit pAb (APR27423N) .

Synonyms

ULK4; FAM7C1; REC01035

Gene ID

54986

UniProt

Q96C45

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 142kDa Observed MW: 160KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54986

Uniprot URL

https://www.uniprot.org/uniprot/Q96C45

AA Sequence

MENFILYEEIGRGSKTVVYKGRRKGTINFVAILCTDKCKRPEITNWVRLTREIKHKNIVTFHEWYETSNHLWLVVELCTGGSLKTVIAQDENLPEDVVREFGIDLISGLHHLHKLGILFCDISPRKILLEGPGTLKFSNFCLAKVEGENLEEFFALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAPEVVRGADFSISSDLWSLGCLLYEMFSGKPPFFSESISELTEKILCEDPLPPIPKDSSRPKASSDFINLLDGLLQRDPQKRLTWTRLLQHSFWKKAFAGADQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Long PCR Master Mix
B2023937 100 Reactions

Long PCR Master Mix

Sign In for Pricing
View Details
P/P028/NT/TW-DIA200-1 Prohibited Activity Signs & Labels (Adhesive)
235326 1 Pack (1 Panel (s) x 1 Pack)

P/P028/NT/TW-DIA200-1 Prohibited Activity Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Nfkbie Mouse siRNA Oligo Duplex (Locus ID 18037)
SR412293 1 Kit

Nfkbie Mouse siRNA Oligo Duplex (Locus ID 18037)

Sign In for Pricing
View Details
RPS6KA3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
42594124 3x 1.0µg DNA

RPS6KA3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Anti-Glutamine Synthetase Rabbit pAb
GB111177-50 50 μL

Anti-Glutamine Synthetase Rabbit pAb

Sign In for Pricing
View Details
SH3GLB1 (Endophilin-B1, Bax-interacting Factor 1, Bif-1, SH3 Domain-containing GRB2-like Protein B1, KIAA0491, CGI-61) (MaxLight 550)
MBS6394131-01 0.1 mL

SH3GLB1 (Endophilin-B1, Bax-interacting Factor 1, Bif-1, SH3 Domain-containing GRB2-like Protein B1, KIAA0491, CGI-61) (MaxLight 550)

Sign In for Pricing
View Details