Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caspr2/CNTNAP2 Rabbit pAb (APR27418N)

Product Specifications

Background

This gene encodes a member of the neurexin family which functions in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, thrombospondin N-terminal-like domains and a putative PDZ binding site. This protein is localized at the juxtaparanodes of myelinated axons, and mediates interactions between neurons and glia during nervous system development and is also involved in localization of potassium channels within differentiating axons. This gene encompasses almost 1.5% of chromosome 7 and is one of the largest genes in the human genome. It is directly bound and regulated by forkhead box protein P2 (FOXP2), a transcription factor related to speech and language development. This gene has been implicated in multiple neurodevelopmental disorders, including Gilles de la Tourette syndrome, schizophrenia, epilepsy, autism, ADHD and mental retardation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Caspr2/CNTNAP2 Rabbit pAb (APR27418N) .

Synonyms

CNTNAP2; AUTS15; CASPR2; CDFE; NRXN4; PTHSL1

Gene ID

26047

UniProt

Q9UHC6

Cellular Locus

Cell projection, Membrane, Single-pass type I membrane protein, axon

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa/148kDa Observed MW: 160kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26047

Uniprot URL

https://www.uniprot.org/uniprot/Q9UHC6

AA Sequence

GCSYWADVINFDGHVVLPYRFRNKKMKTLKDVIALNFKTSESEGVILHGEGQQGDYITLELKKAKLVLSLNLGSNQLGPIYGHTSVMTGSLLDDHHWHSVVIERQGRSINLTLDRSMQHFRTNGEFDYLDLDYEITFGGIPFSGKPSSSSRKNFKGCMESINYNGVNITDLARRKKLEPSNVGNLSFSCVEPYTVPVFFNATSYLEVPGRLNQDLFSVSFQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)
MBS6167011-01 0.1 mL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)

Sign In for Pricing
View Details
IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)
MBS6167011-02 5x 0.1 mL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)

Sign In for Pricing
View Details
Lat 3'UTR GFP Stable Cell Line
TU160917 1.0 mL

Lat 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
∆4-Tibolone
TRC-T437505-25MG 25 mg

∆4-Tibolone

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri rpmC Protein (aa 1-71) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9761-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Kluyveri rpmC Protein (aa 1-71) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
IL15 (Interleukin 15, IL-15, MGC9721) (AP)
MBS6162229-01 0.1 mL

IL15 (Interleukin 15, IL-15, MGC9721) (AP)

Sign In for Pricing
View Details