Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit pAb (APR27413N)

Product Specifications

Background

Plays an essential role in autophagy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TM9SF1 Rabbit pAb (APR27413N) .

Synonyms

TM9SF1; HMP70; MP70

Gene ID

10548

UniProt

O15321

Cellular Locus

Cytoplasmic vesicle, Lysosome membrane, Multi-pass membrane protein, autophagosome membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/68kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10548

Uniprot URL

https://www.uniprot.org/uniprot/O15321

AA Sequence

PGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)
MBS6181270-01 0.1 mL

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)

Sign In for Pricing
View Details
RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)
MBS6181270-02 5x 0.1 mL

RXRA (Retinoid X Receptor, alpha, FLJ00280, FLJ00318, FLJ16020, FLJ16733, MGC102720, NR2B1) (HRP)

Sign In for Pricing
View Details
Eprhin Receptor A6 Antibody Antigenic Blocking Peptide
MBS543644-01 0.25 mg

Eprhin Receptor A6 Antibody Antigenic Blocking Peptide

Sign In for Pricing
View Details
Eprhin Receptor A6 Antibody Antigenic Blocking Peptide
MBS543644-02 5x 0.25 mg

Eprhin Receptor A6 Antibody Antigenic Blocking Peptide

Sign In for Pricing
View Details
ZNF687 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2725508 1.0 µg DNA

ZNF687 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
DHFR (Dihydrofolate Reductase) BioAssayTM ELISA Kit (Rat) discontinued
396383-01 48 Tests

DHFR (Dihydrofolate Reductase) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details