Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit pAb (APR27413N)

Product Specifications

Background

Plays an essential role in autophagy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TM9SF1 Rabbit pAb (APR27413N) .

Synonyms

TM9SF1; HMP70; MP70

Gene ID

10548

UniProt

O15321

Cellular Locus

Cytoplasmic vesicle, Lysosome membrane, Multi-pass membrane protein, autophagosome membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/68kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10548

Uniprot URL

https://www.uniprot.org/uniprot/O15321

AA Sequence

PGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human HLA class II DR/DQ Mouse Monoclonal Antibody (TBS10231) - 100 UG
TBS10231-100 100 µg

Anti-Human HLA class II DR/DQ Mouse Monoclonal Antibody (TBS10231) - 100 UG

Sign In for Pricing
View Details
Human NICN1 Pre-designed siRNA Set B
SI010541B 1 Each

Human NICN1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 750) discontinued
248871-ML750 100 µL

MR1 (Major Histocompatibility Complex, Class I-Related, HLALS) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human Matrix Extracellular Phosphoglycoprotein (MEPE) ELISA Kit
RD-MEPE-Hu-96Tests 96 Tests

Human Matrix Extracellular Phosphoglycoprotein (MEPE) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human DNM1L sgRNA gene knockout kit - Lentiviral human DNM1L sgRNA gene knockout kit (25)
GTR15377286 1 Vial

Lentiviral human DNM1L sgRNA gene knockout kit - Lentiviral human DNM1L sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) OVA7 Polyclonal Antibody
MBS9010139 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) OVA7 Polyclonal Antibody

Sign In for Pricing
View Details