Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF1 Rabbit pAb (APR27413N)

Product Specifications

Background

Plays an essential role in autophagy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TM9SF1 Rabbit pAb (APR27413N) .

Synonyms

TM9SF1; HMP70; MP70

Gene ID

10548

UniProt

O15321

Cellular Locus

Cytoplasmic vesicle, Lysosome membrane, Multi-pass membrane protein, autophagosome membrane

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/68kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10548

Uniprot URL

https://www.uniprot.org/uniprot/O15321

AA Sequence

PGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta Receptor II (TGFBR2) Rabbit mAb
E45R12700N-50 50 µL

TGF beta Receptor II (TGFBR2) Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal Thyroid Peroxidase Antibody (TPO35) [HRP]
NBP1-50813H 0.25 mL

Mouse Monoclonal Thyroid Peroxidase Antibody (TPO35) [HRP]

Sign In for Pricing
View Details
Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit
MBS452990-01 48 Tests

Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit
MBS452990-02 96 Tests

Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit
MBS452990-03 5x 96 Tests

Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit
MBS452990-04 10x 96 Tests

Human Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details