Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GL1 Rabbit pAb (APR27401N)

Product Specifications

Background

This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SH3GL1 Rabbit pAb (APR27401N) .

Synonyms

SH3GL1; CNSA1; EEN; SH3D2B; SH3P8

Gene ID

6455

UniProt

Q99961

Cellular Locus

Cell projection, Cytoplasm, Early endosome membrane, Peripheral membrane protein, podosome

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa/36kDa/41kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6455

Uniprot URL

https://www.uniprot.org/uniprot/Q99961

AA Sequence

VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein
abx167859-01 10 µg

Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein

Sign In for Pricing
View Details
Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein
abx167859-02 50 µg

Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein

Sign In for Pricing
View Details
Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein
abx167859-03 100 µg

Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein

Sign In for Pricing
View Details
Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein
abx167859-04 200 µg

Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein

Sign In for Pricing
View Details
Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein
abx167859-05 500 µg

Human Heat Shock 70 kDa Protein 1A (HSPA1A) Protein

Sign In for Pricing
View Details
Mouse Btbd7 qPCR Primer Pair
QM61966S 200 Tests

Mouse Btbd7 qPCR Primer Pair

Sign In for Pricing
View Details