Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB48 Rabbit pAb (APR27387N)

Product Specifications

Background

Telomere-binding protein that acts as a regulator of telomere length. Directly binds the telomeric double-stranded 5'-TTAGGG-3' repeat. Preferentially binds to telomeres that have a low concentration of shelterin complex and acts as a regulator of telomere length by initiating telomere trimming, a process that prevents the accumulation of aberrantly long telomeres. Also acts as a transcription regulator that binds to promoter regions. Regulates expression of a small subset of genes, including MTFP1. Regulates expression the J and/or S elements in MHC II promoter. Acts as a negative regulator of cell proliferation by specifically activating expression of ARF, a tumor suppressor isoform of CDKN2A.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZBTB48 Rabbit pAb (APR27387N) .

Synonyms

ZBTB48; HKR3; TZAP; ZNF855; pp9964

Gene ID

3104

UniProt

P10074

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa Observed MW: 77kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3104

Uniprot URL

https://www.uniprot.org/uniprot/P10074

AA Sequence

MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A20, CT (SLC25A20, CAC, CACT, Mitochondrial carnitine/acylcarnitine carrier protein, Carnitine/acylcarnitine translocase, Solute carrier family 25 member 20) (Azide free) (HRP)
MBS6348246-01 0.2 mL

SLC25A20, CT (SLC25A20, CAC, CACT, Mitochondrial carnitine/acylcarnitine carrier protein, Carnitine/acylcarnitine translocase, Solute carrier family 25 member 20) (Azide free) (HRP)

Sign In for Pricing
View Details
SLC25A20, CT (SLC25A20, CAC, CACT, Mitochondrial carnitine/acylcarnitine carrier protein, Carnitine/acylcarnitine translocase, Solute carrier family 25 member 20) (Azide free) (HRP)
MBS6348246-02 5x 0.2 mL

SLC25A20, CT (SLC25A20, CAC, CACT, Mitochondrial carnitine/acylcarnitine carrier protein, Carnitine/acylcarnitine translocase, Solute carrier family 25 member 20) (Azide free) (HRP)

Sign In for Pricing
View Details
Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)
MBS2169750-01 0.1 mL

Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details
Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)
MBS2169750-02 0.2 mL

Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details
Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)
MBS2169750-03 0.5 mL

Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details
Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)
MBS2169750-04 1 mL

Monoclonal Antibody to Homing Associated Cell Adhesion Molecule (HCAM)

Sign In for Pricing
View Details