Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] CD34 Rabbit pAb (APR27381N)

Product Specifications

Background

The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CD34 Rabbit pAb (APR27381N) .

Synonyms

CD34; CD34 molecule; GIG3; MORT1

Gene ID

947

UniProt

P28906

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/40kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=947

Uniprot URL

https://www.uniprot.org/uniprot/P28906

AA Sequence

PYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MTRF1L Pre-designed siRNA Set B
SI010015B 1 Each

Human MTRF1L Pre-designed siRNA Set B

Sign In for Pricing
View Details
Acetyl-Histone H3 (Lys9) Rabbit Polyclonal Antibody
orb1172488-01 50 μL

Acetyl-Histone H3 (Lys9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acetyl-Histone H3 (Lys9) Rabbit Polyclonal Antibody
orb1172488-02 100 µL

Acetyl-Histone H3 (Lys9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv.trifolii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1071801-01 0.02 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv.trifolii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv.trifolii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1071801-02 0.02 mg (Yeast)

Recombinant Rhizobium leguminosarum bv.trifolii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv.trifolii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)
MBS1071801-03 0.1 mg (E-Coli)

Recombinant Rhizobium leguminosarum bv.trifolii Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD)

Sign In for Pricing
View Details