Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM173B Rabbit pAb (APR27363N)

Product Specifications

Background

Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration. Promotes chronic pain. Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS and on the engagement of spinal cord microglia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FAM173B Rabbit pAb (APR27363N) .

Synonyms

FAM173B; JS-2

Gene ID

134145

UniProt

Q6P4H8

Cellular Locus

Membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/26kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=134145

Uniprot URL

https://www.uniprot.org/uniprot/Q6P4H8

AA Sequence

MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 550)
MBS6384759-01 0.1 mL

MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 550)

Sign In for Pricing
View Details
MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 550)
MBS6384759-02 5x 0.1 mL

MAP Kinase Interacting Serine/threonine Kinase 2 (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (MaxLight 550)

Sign In for Pricing
View Details
LIPE Antibody, Biotin conjugated
A27579-100UG 100 µg

LIPE Antibody, Biotin conjugated

Sign In for Pricing
View Details
Dysprosium oxide, 99.99%
GX8951-100g 100 g

Dysprosium oxide, 99.99%

Sign In for Pricing
View Details
TMSB10 Adenovirus (Rat)
47156056 1.0 mL

TMSB10 Adenovirus (Rat)

Sign In for Pricing
View Details
alpha Synuclein antibody
20R-2433 50 ug

alpha Synuclein antibody

Sign In for Pricing
View Details