Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM173B Rabbit pAb (APR27363N)

Product Specifications

Background

Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration. Promotes chronic pain. Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS and on the engagement of spinal cord microglia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FAM173B Rabbit pAb (APR27363N) .

Synonyms

FAM173B; JS-2

Gene ID

134145

UniProt

Q6P4H8

Cellular Locus

Membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/26kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=134145

Uniprot URL

https://www.uniprot.org/uniprot/Q6P4H8

AA Sequence

MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Anti-Secreted Frizzled Related Protein 1 (SFRP1)
FY-AB43164-01 1 mL

Biotin-Linked Anti-Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Secreted Frizzled Related Protein 1 (SFRP1)
FY-AB43164-02 100 µL

Biotin-Linked Anti-Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details
Biotin-Linked Anti-Secreted Frizzled Related Protein 1 (SFRP1)
FY-AB43164-03 200 µL

Biotin-Linked Anti-Secreted Frizzled Related Protein 1 (SFRP1)

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: fCD8]
AM08112PU-N 500 µg

CD8A Mouse Monoclonal Antibody [Clone ID: fCD8]

Sign In for Pricing
View Details
Lentiviral human PLPPR4 shRNA (UAS) - Lentiviral human PLPPR4 shRNA (UAS) (25)
GTR15105869 1 Vial

Lentiviral human PLPPR4 shRNA (UAS) - Lentiviral human PLPPR4 shRNA (UAS) (25)

Sign In for Pricing
View Details
HSP70 Interacting Protein Human (Recombinant)
22061039-1 10 µg

HSP70 Interacting Protein Human (Recombinant)

Sign In for Pricing
View Details