Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM173B Rabbit pAb (APR27363N)

Product Specifications

Background

Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration. Promotes chronic pain. Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS and on the engagement of spinal cord microglia.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FAM173B Rabbit pAb (APR27363N) .

Synonyms

FAM173B; JS-2

Gene ID

134145

UniProt

Q6P4H8

Cellular Locus

Membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/26kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=134145

Uniprot URL

https://www.uniprot.org/uniprot/Q6P4H8

AA Sequence

MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal RANK/TNFRSF11A Antibody (107) [DyLight 405]
NBP2-90324V 0.1 mL

Rabbit Monoclonal RANK/TNFRSF11A Antibody (107) [DyLight 405]

Request Quote
View Details
RPL23AP1-set siRNA/shRNA/RNAi Lentivector (Human)
41132091 4x 500 ng

RPL23AP1-set siRNA/shRNA/RNAi Lentivector (Human)

Request Quote
View Details
SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (Azide free) (HRP)
MBS6500759-01 0.2 mL

SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (Azide free) (HRP)

Request Quote
View Details
SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (Azide free) (HRP)
MBS6500759-02 5x 0.2 mL

SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (Azide free) (HRP)

Request Quote
View Details
PDCD10 (Programmed Cell Death 10, CCM3, MGC1212, MGC24477, TFAR15) (MaxLight 490)
249899-ML490 100 µL

PDCD10 (Programmed Cell Death 10, CCM3, MGC1212, MGC24477, TFAR15) (MaxLight 490)

Request Quote
View Details
Goat F(ab')2 Anti-Mouse IgM, Human ads-BIOT
MBS674377-01 0.5 mg

Goat F(ab')2 Anti-Mouse IgM, Human ads-BIOT

Request Quote
View Details