Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IWS1 Rabbit pAb (APR27339N)

Product Specifications

Background

Transcription factor which plays a key role in defining the composition of the RNA polymerase II (RNAPII elongation complex and in modulating the production of mature mRNA transcripts. Acts as an assembly factor to recruit various factors to the RNAPII elongation complex and is recruited to the complex via binding to the transcription elongation factor SUPT6H bound to the C-terminal domain (CTD of the RNAPII subunit RPB1 (POLR2A. The SUPT6H:IWS1:CTD complex recruits mRNA export factors (ALYREF/THOC4, EXOSC10 as well as histone modifying enzymes (such as SETD2 to ensure proper mRNA splicing, efficient mRNA export and elongation-coupled H3K36 methylation, a signature chromatin mark of active transcription.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IWS1 Rabbit pAb (APR27339N) .

Synonyms

IWS1

Gene ID

55677

UniProt

Q96ST2

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/69kDa/91kDa Observed MW: 92kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55677

Uniprot URL

https://www.uniprot.org/uniprot/Q96ST2

AA Sequence

AAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMTREEREQRDLEQMPQRRRMNSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEMESSRFQATSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS627017 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
FETUB CRISPR Knock Out 293T Cell Line (Human)
20465141 1x 10^6 Cells / 1.0 mL

FETUB CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Chicken V-Set and Transmembrane Domain-Containing Protein 2A (VSTM2A) ELISA Kit
MBS9923389 Inquire

Chicken V-Set and Transmembrane Domain-Containing Protein 2A (VSTM2A) ELISA Kit

Sign In for Pricing
View Details
Acetyl-Histone H3.1 (Lys24) Recombinant Antibody, APC-Cy7 Conjugated
bsm-62436R-APC-Cy7 100 µL

Acetyl-Histone H3.1 (Lys24) Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
NPR3 Polyclonal Antibody
MBS8571572-01 0.1 mL

NPR3 Polyclonal Antibody

Sign In for Pricing
View Details
NPR3 Polyclonal Antibody
MBS8571572-02 0.1 mL (AF405L)

NPR3 Polyclonal Antibody

Sign In for Pricing
View Details