Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT20H Rabbit pAb (APR27338N)

Product Specifications

Background

Required for MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14 activation during gastrulation. Required for down-regulation of E-cadherin during gastrulation by regulating E-cadherin protein level downstream from NCK-interacting kinase (NIK and independently of the regulation of transcription by FGF signaling and Snail (By similarity. Required for starvation-induced ATG9A trafficking during autophagy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SUPT20H Rabbit pAb (APR27338N) .

Synonyms

SUPT20H; C13; C13orf19; FAM48A; FP757; P38IP; SPT20

Gene ID

55578

UniProt

Q8NEM7

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 80kDa/85kDa/88kDa Observed MW: 86kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55578

Uniprot URL

https://www.uniprot.org/uniprot/Q8NEM7

AA Sequence

NLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cxcr3 activation kit by CRISPRa
GA200768 1 Kit

Mouse Cxcr3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Gephyrin Antibody
RC-15112-01 50 μL

Recombinant Gephyrin Antibody

Sign In for Pricing
View Details
Recombinant Gephyrin Antibody
RC-15112-02 100 µL

Recombinant Gephyrin Antibody

Sign In for Pricing
View Details
Recombinant Gephyrin Antibody
RC-15112-03 1 mL

Recombinant Gephyrin Antibody

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF640R conjugate, 0.1mg/mL
BNC401815-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAMP2 (NM_005854) Human Over-expression Lysate
LY401774 100 µg

RAMP2 (NM_005854) Human Over-expression Lysate

Sign In for Pricing
View Details