Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF264 Rabbit pAb (APR27324N)

Product Specifications

Background

This gene encodes a zinc finger protein and belongs to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are often localized in the nucleus, bind nucleic acids, and regulate transcription.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF264 Rabbit pAb (APR27324N) .

Synonyms

ZNF264

Gene ID

9422

UniProt

O43296

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 70kDa Observed MW: 71kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9422

Uniprot URL

https://www.uniprot.org/uniprot/O43296

AA Sequence

MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPKAELICHLEHGQEPWTRKEDLSQDTCPGDKGKPKTTEPTTCEPALSEGISLQGQVTQGNSVDSQLGQAEDQDGLSEMQEGHFRPGIDPQEKSPGKMSPECDGLGTADGVCSRIGQEQVSPGDRVRSHNSCESGKDPMIQEEENNFKCSECGKVFNKKHLLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC2 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 2, ABC30, CMOAT, DJS, KIAA1010, MRP2, cMRP) (Biotin)
242978-Biotin 100 µL

ABCC2 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 2, ABC30, CMOAT, DJS, KIAA1010, MRP2, cMRP) (Biotin)

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)
MBS9020009-01 0.02 mg (E-Coli)

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)
MBS9020009-02 0.1 mg (E-Coli)

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)
MBS9020009-03 1 mg (E-Coli)

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Sign In for Pricing
View Details
Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)
MBS9020009-04 5x 1 mg (E-Coli)

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G)

Sign In for Pricing
View Details
Mouse Monoclonal Orexin B/Hypocretin-2 Antibody (MM0501-5G21) [Alexa Fluor 594]
NBP2-11834AF594 0.1 mL

Mouse Monoclonal Orexin B/Hypocretin-2 Antibody (MM0501-5G21) [Alexa Fluor 594]

Sign In for Pricing
View Details