Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPF1 Rabbit pAb (APR27317N)

Product Specifications

Background

May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex. During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF. The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DPF1 Rabbit pAb (APR27317N) .

Synonyms

DPF1; BAF45b; NEUD4; neuro-d4

Gene ID

8193

UniProt

Q92782

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa/42kDa/46kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8193

Uniprot URL

https://www.uniprot.org/uniprot/Q92782

AA Sequence

VIPNGYCDFCLGGSKKTGCPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKEKASAYITLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (Biotin)
MBS6171602-01 0.1 mL

PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (Biotin)

Sign In for Pricing
View Details
PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (Biotin)
MBS6171602-02 5x 0.1 mL

PUM2 (Pumilio Homolog 2 (Drosophila), FLJ36528, KIAA0235, MGC138251, MGC138253, PUMH2, PUML2) (Biotin)

Sign In for Pricing
View Details
XCL2 Human Over-expression Lysate
orb1365703 20 µg

XCL2 Human Over-expression Lysate

Sign In for Pricing
View Details
Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit
ELK7721-01 48 Tests

Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit

Sign In for Pricing
View Details
Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit
ELK7721-02 96 Tests

Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit

Sign In for Pricing
View Details
Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit
ELK7721-03 5x 96 Tests

Rat HSPG (Heparan Sulfate Proteoglycan) ELISA Kit

Sign In for Pricing
View Details