Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1G2 Rabbit pAb (APR27294N)

Product Specifications

Background

Serine/threonine-protein kinase. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates COL4A3BP/CERT, MTA1 and SMAD3. Involved in brain development and vesicular trafficking and neurotransmitter releasing from small synaptic vesicles. Regulates fast synaptic transmission mediated by glutamate. SMAD3 phosphorylation promotes its ligand-dependent ubiquitination and subsequent proteasome degradation, thus inhibiting SMAD3-mediated TGF-beta responses. Hyperphosphorylation of the serine-repeat motif of COL4A3BP/CERT leads to its inactivation by dissociation from the Golgi complex, thus down-regulating ER-to-Golgi transport of ceramide and sphingomyelin synthesis. Triggers PER1 proteasomal degradation probably through phosphorylation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CSNK1G2 Rabbit pAb (APR27294N) .

Synonyms

CSNK1G2; CK1g2

Gene ID

1455

UniProt

P78368

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1455

Uniprot URL

https://www.uniprot.org/uniprot/P78368

AA Sequence

FDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQLRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIN CytoSection
TS405689P5 25 Slides

KIN CytoSection

Sign In for Pricing
View Details
PLV3-CMV-KAT5-3xHA-Puro Plasmid
PVT72247 2 µg

PLV3-CMV-KAT5-3xHA-Puro Plasmid

Sign In for Pricing
View Details
Phospho-ATM (Ser794) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-12545R-BF555 100 µL

Phospho-ATM (Ser794) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
TTLL2 siRNA (Mouse)
orb1833939-01 15 nmol

TTLL2 siRNA (Mouse)

Sign In for Pricing
View Details
TTLL2 siRNA (Mouse)
orb1833939-02 30 nmol

TTLL2 siRNA (Mouse)

Sign In for Pricing
View Details
Fomepizole hydrochloride
orb1745027-01 25 mg

Fomepizole hydrochloride

Sign In for Pricing
View Details