Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIAP1 Rabbit pAb (APR27284N)

Product Specifications

Background

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA between liposomes (in vitro and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo. Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIAP1 Rabbit pAb (APR27284N) .

Synonyms

TRIAP1; HSPC132; MDM35; P53CSV; WF-1

Gene ID

51499

UniProt

O43715

Cellular Locus

Cytoplasm, Mitochondrion, Mitochondrion intermembrane space, perinuclear region

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51499

Uniprot URL

https://www.uniprot.org/uniprot/O43715

AA Sequence

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR157 Antibody - C-terminal region
ARP68397_P050-25UL 25 µL

GPR157 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)
MBS1123603-01 0.02 mg (E-Coli)

Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)

Sign In for Pricing
View Details
Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)
MBS1123603-02 0.02 mg (Yeast)

Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)

Sign In for Pricing
View Details
Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)
MBS1123603-03 0.1 mg (E-Coli)

Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)

Sign In for Pricing
View Details
Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)
MBS1123603-04 0.1 mg (Yeast)

Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)

Sign In for Pricing
View Details
Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)
MBS1123603-05 0.02 mg (Baculovirus)

Recombinant Saccharopolyspora erythraea Type III pantothenate kinase (coaX)

Sign In for Pricing
View Details