Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD5 Rabbit pAb (APR27275N)

Product Specifications

Background

This function of this gene has yet to be determined but mutations in this gene have been associated with autosomal dominant mental retardation-23. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SETD5 Rabbit pAb (APR27275N) .

Synonyms

SETD5

Gene ID

55209

UniProt

Q9C0A6

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 145kDa/147kDa/157kDa Observed MW: 158KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55209

Uniprot URL

https://www.uniprot.org/uniprot/Q9C0A6

AA Sequence

HAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVECPLRITTDPTVLATTLNMLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifitm1 AAV siRNA Pooled Vector
24232166 1.0 µg

Ifitm1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Zfp334 Mouse siRNA Oligo Duplex (Locus ID 228876)
SR419042 1 Kit

Zfp334 Mouse siRNA Oligo Duplex (Locus ID 228876)

Sign In for Pricing
View Details
W/W079/NL524-ALU-148X210/1 Electrical & Equipment Safety Signs (No Adhesive)
319585 1 Pack (1 Panel (s) x 1 Pack)

W/W079/NL524-ALU-148X210/1 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
HDAC4, CT (HDAC4, KIAA0288, Histone deacetylase 4) (FITC) discontinued
036479-FITC 200 µL

HDAC4, CT (HDAC4, KIAA0288, Histone deacetylase 4) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor alpha ELISA Kit
MBS046399-01 48 Well

Mouse Tumor Necrosis Factor alpha ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor alpha ELISA Kit
MBS046399-02 96 Well

Mouse Tumor Necrosis Factor alpha ELISA Kit

Sign In for Pricing
View Details