Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKAG1 Rabbit pAb (APR27272N)

Product Specifications

Background

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK) . AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRKAG1 Rabbit pAb (APR27272N) .

Synonyms

PRKAG1; AMPKG

Gene ID

5571

UniProt

P54619

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa/37kDa/38kDa Observed MW: 36kDa/38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5571

Uniprot URL

https://www.uniprot.org/uniprot/P54619

AA Sequence

METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYDP1 rabbit pAb
ES12477-01 50 µL

TYDP1 rabbit pAb

Sign In for Pricing
View Details
TYDP1 rabbit pAb
ES12477-02 100 µL

TYDP1 rabbit pAb

Sign In for Pricing
View Details
Anti-CSH1 Monoclonal Antibody
TMAZ-0399-01 25 µg

Anti-CSH1 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-CSH1 Monoclonal Antibody
TMAZ-0399-02 50 µg

Anti-CSH1 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-CSH1 Monoclonal Antibody
TMAZ-0399-03 100 µg

Anti-CSH1 Monoclonal Antibody

Sign In for Pricing
View Details
Medium for Rabbit Annulus Fibrosus Cells (AFC)
abx710036-01 100 mL

Medium for Rabbit Annulus Fibrosus Cells (AFC)

Sign In for Pricing
View Details