Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCD Rabbit pAb (APR27253N)

Product Specifications

Background

This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DCD Rabbit pAb (APR27253N) .

Synonyms

DCD; AIDD; DCD-1; DSEP; HCAP; PIF; dermcidin

Gene ID

117159

UniProt

P81605

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 8kDa/11kDa/12kDa Observed MW: 11kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=117159

Uniprot URL

https://www.uniprot.org/uniprot/P81605

AA Sequence

YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFT2D3 Protein Vector (Mouse) (pPB-C-His)
PV228530 500 ng

SFT2D3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Integrin alpha 6 antibody
MBS837708-01 0.1 mL

Integrin alpha 6 antibody

Sign In for Pricing
View Details
Integrin alpha 6 antibody
MBS837708-02 5x 0.1 mL

Integrin alpha 6 antibody

Sign In for Pricing
View Details
NCX1 (Na/Ca Exchanger) (APC) discontinued
N0560-APC 100 µL

NCX1 (Na/Ca Exchanger) (APC) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Bnip3 shRNA (UAS) - Lentiviral mouse Bnip3 shRNA (UAS, GFP) plasmid
GTR15149374 1 Vial

Lentiviral mouse Bnip3 shRNA (UAS) - Lentiviral mouse Bnip3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human/Mouse BAFF Recombinant Protein DDDDK Tag Lyophilized
MBS8432820-01 0.01 mg

Human/Mouse BAFF Recombinant Protein DDDDK Tag Lyophilized

Sign In for Pricing
View Details