Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF5 Rabbit pAb (APR27215N)

Product Specifications

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes an integral subunit of TFIID associated with all transcriptionally competent forms of that complex. This subunit interacts strongly with two TFIID subunits that show similarity to histones H3 and H4, and it may participate in forming a nucleosome-like core in the TFIID complex. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TAF5 Rabbit pAb (APR27215N) .

Synonyms

TAF5; TAF (II) 100; TAF2D; TAFII-100; TAFII100

Gene ID

6877

UniProt

Q15542

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 80kDa/86kDa Observed MW: 100kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6877

Uniprot URL

https://www.uniprot.org/uniprot/Q15542

AA Sequence

VLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuropeptide Y Receptor Y1 Chemiluminescent Immunoassay Kit
IHUNPYR1KTC 1 Each

Human Neuropeptide Y Receptor Y1 Chemiluminescent Immunoassay Kit

Sign In for Pricing
View Details
PLEKHG6 Polyclonal Antibody
MBS2523198-01 0.02 mL

PLEKHG6 Polyclonal Antibody

Sign In for Pricing
View Details
PLEKHG6 Polyclonal Antibody
MBS2523198-02 0.06 mL

PLEKHG6 Polyclonal Antibody

Sign In for Pricing
View Details
PLEKHG6 Polyclonal Antibody
MBS2523198-03 0.12 mL

PLEKHG6 Polyclonal Antibody

Sign In for Pricing
View Details
PLEKHG6 Polyclonal Antibody
MBS2523198-04 0.2 mL

PLEKHG6 Polyclonal Antibody

Sign In for Pricing
View Details
PLEKHG6 Polyclonal Antibody
MBS2523198-05 5x 0.2 mL

PLEKHG6 Polyclonal Antibody

Sign In for Pricing
View Details