Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N6AMT1 Rabbit pAb (APR27195N)

Product Specifications

Background

This gene encodes an N (6) -adenine-specific DNA methyltransferase. The encoded enzyme may be involved in the methylation of release factor I during translation termination. This enzyme is also involved in converting the arsenic metabolite monomethylarsonous acid to the less toxic dimethylarsonic acid. Alternative splicing pf this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 11.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality N6AMT1 Rabbit pAb (APR27195N) .

Synonyms

N6AMT1; C21orf127; HEMK2; MTQ2; N6AMT; PRED28; m.HsaHemK2P

Gene ID

29104

UniProt

Q9Y5N5

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/22kDa Observed MW: 23KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29104

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5N5

AA Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BMP-5 MAb (Clone 149107)
MAB7151 500 µg

Human BMP-5 MAb (Clone 149107)

Sign In for Pricing
View Details
Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit
abx254683-01 96 Tests

Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit

Sign In for Pricing
View Details
Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit
abx254683-02 5x 96 Tests

Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit

Sign In for Pricing
View Details
Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit
abx254683-03 10x 96 Tests

Mouse Activated Leukocyte Cell Adhesion Molecule / CD166 (ALCAM) ELISA Kit

Sign In for Pricing
View Details
Dog aFP (Alpha-Fetoprotein) ELISA Kit
ELK5883-01 48 Tests

Dog aFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
Dog aFP (Alpha-Fetoprotein) ELISA Kit
ELK5883-02 96 Tests

Dog aFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details