Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N6AMT1 Rabbit pAb (APR27195N)

Product Specifications

Background

This gene encodes an N (6) -adenine-specific DNA methyltransferase. The encoded enzyme may be involved in the methylation of release factor I during translation termination. This enzyme is also involved in converting the arsenic metabolite monomethylarsonous acid to the less toxic dimethylarsonic acid. Alternative splicing pf this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 11.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality N6AMT1 Rabbit pAb (APR27195N) .

Synonyms

N6AMT1; C21orf127; HEMK2; MTQ2; N6AMT; PRED28; m.HsaHemK2P

Gene ID

29104

UniProt

Q9Y5N5

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/22kDa Observed MW: 23KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=29104

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5N5

AA Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABP1 ORF Vector (Human) (pORF)
ORF000057 1.0 µg DNA

ABP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human Apolipoprotein C-II ELISA Kit
MBS9427994-01 96 Tests

Human Apolipoprotein C-II ELISA Kit

Sign In for Pricing
View Details
Human Apolipoprotein C-II ELISA Kit
MBS9427994-02 5x 96 Tests

Human Apolipoprotein C-II ELISA Kit

Sign In for Pricing
View Details
FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (AP)
MBS6378647-01 0.1 mL

FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (AP)

Sign In for Pricing
View Details
FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (AP)
MBS6378647-02 5x 0.1 mL

FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (AP)

Sign In for Pricing
View Details
WDR41 Antibody
E51A12055 100 µL

WDR41 Antibody

Sign In for Pricing
View Details