Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM10 Rabbit pAb (APR27193N)

Product Specifications

Background

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre-RC) and it may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein can interact with MCM2 and MCM6, as well as with the origin recognition protein ORC2. It is regulated by proteolysis and phosphorylation in a cell cycle-dependent manner. Studies of a similar protein in Xenopus suggest that the chromatin binding of this protein at the onset of DNA replication is after pre-RC assembly and before origin unwinding. Alternatively spliced transcript variants encoding distinct isoforms have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MCM10 Rabbit pAb (APR27193N) .

Synonyms

MCM10; CNA43; DNA43; PRO2249

Gene ID

55388

UniProt

Q7L590

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 98kDa Observed MW: 110KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55388

Uniprot URL

https://www.uniprot.org/uniprot/Q7L590

AA Sequence

RLEGAPATMTPKLGRGVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEKNTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKMRNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYKWERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHFPL3 Human Gene Knockout Kit (CRISPR)
KN420013 1 Kit

LHFPL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKR (EIF2AK2) (C-term) Rabbit Polyclonal Antibody
AP15148PU-N 400 µL

PKR (EIF2AK2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TAF1D activation kit by CRISPRa
GA112370 1 Kit

Human TAF1D activation kit by CRISPRa

Sign In for Pricing
View Details
FP-TZTP, >85%
TRC-F756500-5MG 5 mg

FP-TZTP, >85%

Sign In for Pricing
View Details
Vitamin B12-O5'-NHS Ester
TRC-V675670-5MG 5 mg

Vitamin B12-O5'-NHS Ester

Sign In for Pricing
View Details
BactoViewTM Dead 760/780
#40113 1x 100 µL

BactoViewTM Dead 760/780

Sign In for Pricing
View Details