Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2L15 Rabbit pAb (APR27160N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BCL2L15 Rabbit pAb (APR27160N) .

Synonyms

BCL2L15; Bfk; C1orf178

Gene ID

440603

UniProt

Q5TBC7

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 6kDa/17kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=440603

Uniprot URL

https://www.uniprot.org/uniprot/Q5TBC7

AA Sequence

MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKGQTGAILQDTVESLSKTWCAQDSSLAYERAFLAVSVKLLEYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWENLES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cks1 CRISPR Activation Plasmid (m)
sc-424786-ACT 20 µg

Cks1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
NEUROD2 Rabbit Polyclonal Antibody (HRP)
orb2585172 100 µg

NEUROD2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Acetyl-Histone H4 (Lys12) Rabbit mAb
F0826-100uL*2 2x 100 μL

Acetyl-Histone H4 (Lys12) Rabbit mAb

Sign In for Pricing
View Details
Ankyrin Repeat And SOCS Box Containing 4 (ASB4) Antibody (FITC)
abx316707-01 20 µg

Ankyrin Repeat And SOCS Box Containing 4 (ASB4) Antibody (FITC)

Sign In for Pricing
View Details
Ankyrin Repeat And SOCS Box Containing 4 (ASB4) Antibody (FITC)
abx316707-02 50 µg

Ankyrin Repeat And SOCS Box Containing 4 (ASB4) Antibody (FITC)

Sign In for Pricing
View Details
Ankyrin Repeat And SOCS Box Containing 4 (ASB4) Antibody (FITC)
abx316707-03 100 µg

Ankyrin Repeat And SOCS Box Containing 4 (ASB4) Antibody (FITC)

Sign In for Pricing
View Details