Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U2AF1L4 Rabbit pAb (APR27156N)

Product Specifications

Background

RNA-binding protein that function as a pre-mRNA splicing factor. Plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. Acts by enhancing the binding of U2AF2 to weak pyrimidine tracts. Also participates in the regulation of alternative pre-mRNA splicing. Activates exon 5 skipping of PTPRC during T-cell activation; an event reversed by GFI1. Binds to RNA at the AG dinucleotide at the 3'-splice site (By similarity. Shows a preference for AGC or AGA (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality U2AF1L4 Rabbit pAb (APR27156N) .

Synonyms

U2AF1L4; U2AF1-RS3; U2AF1L3; U2AF1L3V1; U2AF1RS3; U2af26

Gene ID

199746

UniProt

Q8WU68

Cellular Locus

Cytoplasm, Nucleus, Nucleus speckle

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/22kDa/25kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=199746

Uniprot URL

https://www.uniprot.org/uniprot/Q8WU68

AA Sequence

MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,6-Dichloro-1,5-naphthalenediamine
TRC-D143660-100MG 100 mg

2,6-Dichloro-1,5-naphthalenediamine

Sign In for Pricing
View Details
Recombinant Mouse TNFR1/TNFRSF1A Protein (His Tag)
PKSM040648 100 µg

Recombinant Mouse TNFR1/TNFRSF1A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant LYN (phospho Y397) Antibody
RC-15237-01 50 μL

Recombinant LYN (phospho Y397) Antibody

Sign In for Pricing
View Details
Recombinant LYN (phospho Y397) Antibody
RC-15237-02 100 µL

Recombinant LYN (phospho Y397) Antibody

Sign In for Pricing
View Details
Recombinant LYN (phospho Y397) Antibody
RC-15237-03 1 mL

Recombinant LYN (phospho Y397) Antibody

Sign In for Pricing
View Details