Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RXFP1 Rabbit pAb (APR27134N)

Product Specifications

Background

This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane receptor superfamily. The encoded protein plays a critical role in sperm motility, pregnancy and parturition as a receptor for the protein hormone relaxin. Decreased expression of this gene may play a role in endometriosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RXFP1 Rabbit pAb (APR27134N) .

Synonyms

RXFP1; LGR7; RXFPR1

Gene ID

59350

UniProt

Q9HBX9

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/75kDa/81kDa/83kDa/86kDa Observed MW: 87kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=59350

Uniprot URL

https://www.uniprot.org/uniprot/Q9HBX9

AA Sequence

NSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5a (Signal Transducer and Activator of Transcription 5a) (MaxLight 405)
MBS6259090-01 0.1 mL

STAT5a (Signal Transducer and Activator of Transcription 5a) (MaxLight 405)

Sign In for Pricing
View Details
STAT5a (Signal Transducer and Activator of Transcription 5a) (MaxLight 405)
MBS6259090-02 5x 0.1 mL

STAT5a (Signal Transducer and Activator of Transcription 5a) (MaxLight 405)

Sign In for Pricing
View Details
Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6221R-BF594-01 20 µL

Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-6221R-BF594-02 100 µL

Thyroid hormone receptor alpha Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Cleaved-Caspase-1 p20 (N120) Polyclonal Antibody
ABP56679-01 30 µL

Cleaved-Caspase-1 p20 (N120) Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-Caspase-1 p20 (N120) Polyclonal Antibody
ABP56679-02 100 µL

Cleaved-Caspase-1 p20 (N120) Polyclonal Antibody

Sign In for Pricing
View Details