Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RXFP1 Rabbit pAb (APR27134N)

Product Specifications

Background

This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane receptor superfamily. The encoded protein plays a critical role in sperm motility, pregnancy and parturition as a receptor for the protein hormone relaxin. Decreased expression of this gene may play a role in endometriosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RXFP1 Rabbit pAb (APR27134N) .

Synonyms

RXFP1; LGR7; RXFPR1

Gene ID

59350

UniProt

Q9HBX9

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/75kDa/81kDa/83kDa/86kDa Observed MW: 87kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=59350

Uniprot URL

https://www.uniprot.org/uniprot/Q9HBX9

AA Sequence

NSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv
MBS6385210-01 0.1 mL

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv

Sign In for Pricing
View Details
MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv
MBS6385210-02 5x 0.1 mL

MED26 (Mediator of RNA Polymerase II Transcription Subunit 26, Activator-recruited Cofactor 70kD Component, ARC70, Cofactor Required for Sp1 Transcriptional Activation Subunit 7, CRSP Complex Subunit 7, Mediator Complex Subunit 26, Transcriptional Coactiv

Sign In for Pricing
View Details
Pde10a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4676003 1.0 µg DNA

Pde10a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Factor VIIIc (Antihaemophilic Factor) (HRP)
F0016-30B 200 µg

Factor VIIIc (Antihaemophilic Factor) (HRP)

Sign In for Pricing
View Details
Recombinant Human PIR Protein, N-His
HT362012-01 50 µg

Recombinant Human PIR Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PIR Protein, N-His
HT362012-02 100 µg

Recombinant Human PIR Protein, N-His

Sign In for Pricing
View Details