Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EAF2 Rabbit pAb (APR27126N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EAF2 Rabbit pAb (APR27126N) .

Synonyms

EAF2; BM040; TRAITS; U19

Gene ID

55840

UniProt

Q96CJ1

Cellular Locus

Nucleus speckle

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/28kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55840

Uniprot URL

https://www.uniprot.org/uniprot/Q96CJ1

AA Sequence

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mtf2 3'UTR GFP Stable Cell Line
TU263518 1.0 mL

Mtf2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human leukocyte immunoglobulin-like receptor subfamily B member 4,LILRB4 ELISA KIT
JOT-EK0240Hu 96 wells

Human leukocyte immunoglobulin-like receptor subfamily B member 4,LILRB4 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human SORL1 shRNA (UAS) - Lentiviral human SORL1 shRNA (UAS) (100)
GTR15158094 1 Vial

Lentiviral human SORL1 shRNA (UAS) - Lentiviral human SORL1 shRNA (UAS) (100)

Sign In for Pricing
View Details
FITC Anti-Human CD44 Antibody (P2A1)
FITC-30112-01 20 Tests

FITC Anti-Human CD44 Antibody (P2A1)

Sign In for Pricing
View Details
FITC Anti-Human CD44 Antibody (P2A1)
FITC-30112-02 100 Tests

FITC Anti-Human CD44 Antibody (P2A1)

Sign In for Pricing
View Details
Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1A2]
CF506397 100 µg

Galectin 3 (LGALS3) Mouse Monoclonal Antibody [Clone ID: OTI1A2]

Sign In for Pricing
View Details