Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EAF2 Rabbit pAb (APR27126N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EAF2 Rabbit pAb (APR27126N) .

Synonyms

EAF2; BM040; TRAITS; U19

Gene ID

55840

UniProt

Q96CJ1

Cellular Locus

Nucleus speckle

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/28kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55840

Uniprot URL

https://www.uniprot.org/uniprot/Q96CJ1

AA Sequence

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACLY Recombinant Antibody, Cy5 Conjugated
bsm-52458R-Cy5-TR 20 µL

ACLY Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
DUSP8 (NM_004420) Human Over-expression Lysate
LH07192V 100 µg

DUSP8 (NM_004420) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Guinea Pig IgG Fc Secondary Antibody [DyLight 680]
NBP1-72735FR 0.5 mL

Rabbit Polyclonal Rabbit anti-Guinea Pig IgG Fc Secondary Antibody [DyLight 680]

Sign In for Pricing
View Details
STAF65 gamma (SUPT7L) (NM_001282730) Human Tagged ORF Clone
RC238068 10 µg

STAF65 gamma (SUPT7L) (NM_001282730) Human Tagged ORF Clone

Sign In for Pricing
View Details
DAGLB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
17646111 3x 1.0 µg

DAGLB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
FCGR3B Polyclonal Conjugated Antibody
C31372 100 µL

FCGR3B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details