Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TES Rabbit pAb (APR27101N)

Product Specifications

Background

Cancer-associated chromosomal changes often involve regions containing fragile sites. This gene maps to a commom fragile site on chromosome 7q31.2 designated FRA7G. This gene is similar to mouse Testin, a testosterone-responsive gene encoding a Sertoli cell secretory protein containing three LIM domains. LIM domains are double zinc-finger motifs that mediate protein-protein interactions between transcription factors, cytoskeletal proteins and signaling proteins. This protein is a negative regulator of cell growth and may act as a tumor suppressor. This scaffold protein may also play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Multiple protein isoforms are encoded by transcript variants of this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TES Rabbit pAb (APR27101N) .

Synonyms

TES; TESS; TESS-2; testin

Gene ID

26136

UniProt

Q9UGI8

Cellular Locus

Cell junction, Cytoplasm, focal adhesion

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 46kDa/47kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26136

Uniprot URL

https://www.uniprot.org/uniprot/Q9UGI8

AA Sequence

MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human HSPBAP1 shRNA (UAS) - Lentiviral human HSPBAP1 shRNA (UAS) (100)
GTR15108858 1 Vial

Lentiviral human HSPBAP1 shRNA (UAS) - Lentiviral human HSPBAP1 shRNA (UAS) (100)

Ask
View Details
CD150 (CD150 Antigen, Cdw150, Ipo 3, Ipo-3, Signaling Lymphocytic Activation Molecule, SLAM, Signaling Lymphocytic Activation Molecule Family Member 1, SLAMF1 Protein) (Biotin) discontinued
C2548-81W1 100 µg

CD150 (CD150 Antigen, Cdw150, Ipo 3, Ipo-3, Signaling Lymphocytic Activation Molecule, SLAM, Signaling Lymphocytic Activation Molecule Family Member 1, SLAMF1 Protein) (Biotin) discontinued

Ask
View Details
ANKMY2 Antibody
GWB-MU803B 50 µg

ANKMY2 Antibody

Ask
View Details
MMP16, CT (MMP16, MMPX2, Matrix metalloproteinase-16, MMP-X2, Membrane-type matrix metalloproteinase 3, Membrane-type-3 matrix metalloproteinase) (MaxLight 405)
MBS6321377-01 0.1 mL

MMP16, CT (MMP16, MMPX2, Matrix metalloproteinase-16, MMP-X2, Membrane-type matrix metalloproteinase 3, Membrane-type-3 matrix metalloproteinase) (MaxLight 405)

Ask
View Details
MMP16, CT (MMP16, MMPX2, Matrix metalloproteinase-16, MMP-X2, Membrane-type matrix metalloproteinase 3, Membrane-type-3 matrix metalloproteinase) (MaxLight 405)
MBS6321377-02 5x 0.1 mL

MMP16, CT (MMP16, MMPX2, Matrix metalloproteinase-16, MMP-X2, Membrane-type matrix metalloproteinase 3, Membrane-type-3 matrix metalloproteinase) (MaxLight 405)

Ask
View Details
Nell2 Mouse qPCR Primer Pair (NM_016743)
MP208738 200 Reactions

Nell2 Mouse qPCR Primer Pair (NM_016743)

Ask
View Details