Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGR2 Rabbit pAb (APR27073N)

Product Specifications

Background

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AGR2 Rabbit pAb (APR27073N) .

Synonyms

AGR2; AG-2; AG2; GOB-4; HAG-2; HEL-S-116; HPC8; PDIA17; XAG-2

Gene ID

10551

UniProt

O95994

Cellular Locus

Endoplasmic reticulum, Secreted

Applications

IF (Mus musculus) WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10551

Uniprot URL

https://www.uniprot.org/uniprot/O95994

AA Sequence

RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIMAP6
pro-1628 5µg

GIMAP6

Sign In for Pricing
View Details
CSFV Rabbit pAb
E47R2311 100 µL

CSFV Rabbit pAb

Sign In for Pricing
View Details
A530098C11Rik AAV Vector (Mouse) (CMV)
10952104 1 µg

A530098C11Rik AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
RHO1 Antibody
orb849270 2 mg

RHO1 Antibody

Sign In for Pricing
View Details
Gsr Antibody Middle region
ARP89289_P050 100 µL

Gsr Antibody Middle region

Sign In for Pricing
View Details
CDK19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
15695111 3x 1.0 µg

CDK19 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details