Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECE2 Rabbit pAb (APR27058N)

Product Specifications

Background

This gene encodes a member of the M13 family, which includes type 2 integral membrane metallopeptidases. The encoded enzyme is a membrane-bound zinc-dependent metalloprotease. The enzyme catalyzes the cleavage of big endothelin to produce the vasoconstrictor endothelin-1, and plays a role in the processing of several neuroendocrine peptides. It may also have methyltransferase activity. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ECE2 Rabbit pAb (APR27058N) .

Synonyms

ECE2

Gene ID

9718

UniProt

O60344

Cellular Locus

Cytoplasmic granule membrane, Golgi apparatus membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/83kDa/86kDa/91kDa/99kDa Observed MW: 90kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9718

Uniprot URL

https://www.uniprot.org/uniprot/O60344

AA Sequence

MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Lymphotoxin beta ELISA Kit
MBS004929-01 48 Well

Hamster Lymphotoxin beta ELISA Kit

Sign In for Pricing
View Details
Hamster Lymphotoxin beta ELISA Kit
MBS004929-02 96 Well

Hamster Lymphotoxin beta ELISA Kit

Sign In for Pricing
View Details
Hamster Lymphotoxin beta ELISA Kit
MBS004929-03 5x 96 Well

Hamster Lymphotoxin beta ELISA Kit

Sign In for Pricing
View Details
Hamster Lymphotoxin beta ELISA Kit
MBS004929-04 10x 96 Well

Hamster Lymphotoxin beta ELISA Kit

Sign In for Pricing
View Details
Tris (2,2,6,6-tetramethyl-3,5-heptanedionato) scandium (III)
sc-272735 500 mg

Tris (2,2,6,6-tetramethyl-3,5-heptanedionato) scandium (III)

Sign In for Pricing
View Details
HOXA9 (Homeobox Protein Hox-A9, Homeobox Protein Hox-1G, HOX1G) (MaxLight 650)
MBS6481126-01 0.1 mL

HOXA9 (Homeobox Protein Hox-A9, Homeobox Protein Hox-1G, HOX1G) (MaxLight 650)

Sign In for Pricing
View Details