Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMT2 Rabbit pAb (APR27051N)

Product Specifications

Background

This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NMT2 Rabbit pAb (APR27051N) .

Synonyms

NMT2

Gene ID

9397

UniProt

O60551

Cellular Locus

Cytoplasm, Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa Observed MW: 57kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9397

Uniprot URL

https://www.uniprot.org/uniprot/O60551

AA Sequence

MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTP25 (NM_014388) Human Recombinant Protein
TP305756L 1 mg

UTP25 (NM_014388) Human Recombinant Protein

Sign In for Pricing
View Details
Glycolaldehyde-1,2-13C2 (0.1 M in water)
TRC-G641104-5MG 5 mg

Glycolaldehyde-1,2-13C2 (0.1 M in water)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgA,  40nm
GAF-002-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgA, 40nm

Sign In for Pricing
View Details
Plant Growth Chamber BCPG-103
BCPG-103 1 Unit

Plant Growth Chamber BCPG-103

Sign In for Pricing
View Details
Csf2rb Mouse Gene Knockout Kit (CRISPR)
KN503889 1 Kit

Csf2rb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DAAM1 (NM_014992) Human Recombinant Protein
TP317675M 100 µg

DAAM1 (NM_014992) Human Recombinant Protein

Sign In for Pricing
View Details