Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS2 Rabbit pAb (APR27046N)

Product Specifications

Background

Essential component of the COP9 signalosome complex (CSN, a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COPS2 Rabbit pAb (APR27046N) .

Synonyms

COPS2; ALIEN; CSN2; SGN2; TRIP15

Gene ID

9318

UniProt

P61201

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/52kDa Observed MW: 52kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9318

Uniprot URL

https://www.uniprot.org/uniprot/P61201

AA Sequence

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNI3K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-9458R-BF680 100 µL

TNNI3K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Tubby protein homolog Antibody, mAb, Rabbit
A05368-50 50 µL

Tubby protein homolog Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Gas2l3 3'UTR GFP Stable Cell Line
TU156919 1.0 mL

Gas2l3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Bovine Olfactory receptor 10V1 (OR10V1) ELISA Kit
GTR10335157 96 Well

Bovine Olfactory receptor 10V1 (OR10V1) ELISA Kit

Sign In for Pricing
View Details
Lipocalin 1/LCN1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-11286R-PerCP-Cy5.5 100 µL

Lipocalin 1/LCN1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB (phr2aB)
MBS1321843-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB (phr2aB)

Sign In for Pricing
View Details