Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRC1 Rabbit pAb (APR27038N)

Product Specifications

Background

This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus during interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs) . It is necessary for polarizing parallel microtubules and concentrating the factors responsible for contractile ring assembly. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRC1 Rabbit pAb (APR27038N) .

Synonyms

PRC1; ASE1

Gene ID

9055

UniProt

O43663

Cellular Locus

Cytoplasm, Midbody, Nucleus, cytoskeleton, spindle pole

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 61kDa/66kDa/70kDa/71kDa Observed MW: 72kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9055

Uniprot URL

https://www.uniprot.org/uniprot/O43663

AA Sequence

LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IL-2 (mono)
RM701150 0.5 mg

Anti-Mouse IL-2 (mono)

Sign In for Pricing
View Details
FucT-l CRISPR/Cas9 KO Plasmid (m2)
sc-420423-KO-2 20 µg

FucT-l CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
DGCR2 Protein Vector (Mouse) (pPM-C-HA)
PV171812 500 ng

DGCR2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
XIAP Polyclonal Antibody
MBS8571396-01 0.1 mL

XIAP Polyclonal Antibody

Sign In for Pricing
View Details
XIAP Polyclonal Antibody
MBS8571396-02 0.1 mL (AF405L)

XIAP Polyclonal Antibody

Sign In for Pricing
View Details
XIAP Polyclonal Antibody
MBS8571396-03 0.1 mL (AF405S)

XIAP Polyclonal Antibody

Sign In for Pricing
View Details