Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPFF Rabbit pAb (APR27031N)

Product Specifications

Background

This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NPFF Rabbit pAb (APR27031N) .

Synonyms

NPFF; FMRFAL

Gene ID

8620

UniProt

O15130

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8620

Uniprot URL

https://www.uniprot.org/uniprot/O15130

AA Sequence

AEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UROD (Uroporphyrinogen Decarboxylase, UPD, URO-D) (HRP)
135131-HRP 100 µL

UROD (Uroporphyrinogen Decarboxylase, UPD, URO-D) (HRP)

Sign In for Pricing
View Details
OR2H2 Rabbit Polyclonal Antibody
orb584427 100 µL

OR2H2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF3L, NT (EIF3L, EIF3EIP, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit L, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein) (MaxLight 750)
MBS6295059-01 0.1 mL

EIF3L, NT (EIF3L, EIF3EIP, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit L, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein) (MaxLight 750)

Sign In for Pricing
View Details
EIF3L, NT (EIF3L, EIF3EIP, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit L, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein) (MaxLight 750)
MBS6295059-02 5x 0.1 mL

EIF3L, NT (EIF3L, EIF3EIP, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit L, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein) (MaxLight 750)

Sign In for Pricing
View Details
Anti-Yeast ROM1 Antibody, Dylight550 Conjugate
DZ07035-Dylight550 200 µL

Anti-Yeast ROM1 Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details
Olr211 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
34227066 1.0 µg DNA

Olr211 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details