Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2G1 Rabbit pAb (APR27009N)

Product Specifications

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2G1 Rabbit pAb (APR27009N) .

Synonyms

UBE2G1; E217K; UBC7; UBE2G

Gene ID

7326

UniProt

P62253

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7326

Uniprot URL

https://www.uniprot.org/uniprot/P62253

AA Sequence

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD164 Protein, Rat, Recombinant (hFc)
TMPY-03208-01 5 µg

CD164 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
CD164 Protein, Rat, Recombinant (hFc)
TMPY-03208-02 10 µg

CD164 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
CD164 Protein, Rat, Recombinant (hFc)
TMPY-03208-03 20 µg

CD164 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
CD164 Protein, Rat, Recombinant (hFc)
TMPY-03208-04 50 µg

CD164 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
CD164 Protein, Rat, Recombinant (hFc)
TMPY-03208-05 100 µg

CD164 Protein, Rat, Recombinant (hFc)

Sign In for Pricing
View Details
Flavin containing monooxygenase 4/FMO4 Rabbit Polyclonal Antibody (HRP)
orb2576520 100 µg

Flavin containing monooxygenase 4/FMO4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details