Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT4 Rabbit pAb (APR27003N)

Product Specifications

Background

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is essential for mediating responses to IL12 in lymphocytes, and regulating the differentiation of T helper cells. Mutations in this gene may be associated with systemic lupus erythematosus and rheumatoid arthritis. Alternate splicing results in multiple transcript variants that encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STAT4 Rabbit pAb (APR27003N) .

Synonyms

STAT4; SLEB11

Gene ID

6775

UniProt

Q14765

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 85kDa Observed MW: 76kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6775

Uniprot URL

https://www.uniprot.org/uniprot/Q14765

AA Sequence

WIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmocollin 3 Recombinant Rabbit Monoclonal Antibody [JE55-86]
ET7111-26 100 µL

Desmocollin 3 Recombinant Rabbit Monoclonal Antibody [JE55-86]

Sign In for Pricing
View Details
(2S,4S)-Sacubitril
TRC-S080915-5MG 5 mg

(2S,4S)-Sacubitril

Sign In for Pricing
View Details
Mouse Eftud2 activation kit by CRISPRa
GA204008 1 Kit

Mouse Eftud2 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF405S conjugate, 0.1mg/mL
BNC042304-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DGKD Rabbit Polyclonal Antibody
AP06741PU-N 100 µg

DGKD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRITC Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-
R-5901-5 5 mg

TRITC Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-

Sign In for Pricing
View Details