Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL8 Rabbit pAb (APR26989N)

Product Specifications

Background

This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCL8 Rabbit pAb (APR26989N) .

Synonyms

CCL8; HC14; MCP-2; MCP2; SCYA10; SCYA8

Gene ID

6355

UniProt

P80075

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6355

Uniprot URL

https://www.uniprot.org/uniprot/P80075

AA Sequence

AQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium (Na) Colorimetric Assay Kit
E-BC-K207-M-01 48 T (44 samples)

Sodium (Na) Colorimetric Assay Kit

Sign In for Pricing
View Details
Sodium (Na) Colorimetric Assay Kit
E-BC-K207-M-02 96 T (92 samples)

Sodium (Na) Colorimetric Assay Kit

Sign In for Pricing
View Details
CD1E, ID (CD1E, T-cell surface glycoprotein CD1e, membrane-associated, R2G1, CD1e, T-cell surface glycoprotein CD1e, soluble) (MaxLight 650) discontinued
033473-ML650 100 µL

CD1E, ID (CD1E, T-cell surface glycoprotein CD1e, membrane-associated, R2G1, CD1e, T-cell surface glycoprotein CD1e, soluble) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Peptide YY Antibody (1) [Biotin]
NBP1-05167B 0.1 mL

Mouse Monoclonal Peptide YY Antibody (1) [Biotin]

Sign In for Pricing
View Details
SPTLC1 Antibody
MBS7124892-01 0.05 mL

SPTLC1 Antibody

Sign In for Pricing
View Details
SPTLC1 Antibody
MBS7124892-02 0.1 mL

SPTLC1 Antibody

Sign In for Pricing
View Details