Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPLP2 Rabbit pAb (APR26986N)

Product Specifications

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPLP2 Rabbit pAb (APR26986N) .

Synonyms

RPLP2; D11S2243E; LP2; P2; RPP2

Gene ID

6181

UniProt

P05387

Dilution

IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6181

Uniprot URL

https://www.uniprot.org/uniprot/P05387

AA Sequence

MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nup88 (NM_001083331) AAV Particle
MR215959A1V 250 µL

Mouse Nup88 (NM_001083331) AAV Particle

Sign In for Pricing
View Details
ABCB5 Antibody
MBS7123272-01 0.05 mL

ABCB5 Antibody

Sign In for Pricing
View Details
ABCB5 Antibody
MBS7123272-02 0.1 mL

ABCB5 Antibody

Sign In for Pricing
View Details
ABCB5 Antibody
MBS7123272-03 5x 0.1 mL

ABCB5 Antibody

Sign In for Pricing
View Details
Annexin A7 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61172R-PE-Cy5-01 20 µL

Annexin A7 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Annexin A7 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61172R-PE-Cy5-02 100 µL

Annexin A7 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details